SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019933 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019933
Domain Number 1 Region: 170-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000135
Family I set domains 0.079
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000019933
Domain Number - Region: 279-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00364
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019933   Gene: ENSGGOG00000000953   Transcript: ENSGGOT00000031932
Sequence length 455
Comment pep:known_by_projection chromosome:gorGor3.1:11:116465540:116469971:1 gene:ENSGGOG00000000953 transcript:ENSGGOT00000031932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLGERRSLWGRGAWSMSVCECACVQGVVARMLVASAYLRVCASLYCSLESVLASAPAGC
PCVCWVGLCVWALPFVSVPSPLGAGLHLRFRTWFFLFLESKFLEQLLGLPAVIWLTGRPA
PFSQQPRAQARATMALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENER
HAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNC
SLQDPSSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWID
QDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPS
RRPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELL
DPEPGGLLTSRGFIRLPMLGYIYRVSSVSSDEIWL
Download sequence
Identical sequences ENSGGOP00000019933 ENSGGOP00000019933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]