SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020037 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020037
Domain Number 1 Region: 114-225
Classification Level Classification E-value
Superfamily Immunoglobulin 6.73e-51
Family I set domains 0.0000014
Further Details:      
 
Domain Number 2 Region: 24-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000652
Family I set domains 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020037   Gene: ENSGGOG00000003248   Transcript: ENSGGOT00000023613
Sequence length 403
Comment pep:known_by_projection chromosome:gorGor3.1:19:421442:431692:1 gene:ENSGGOG00000003248 transcript:ENSGGOT00000023613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACAERGGASVQ
WRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLT
VSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDE
DVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPAWITSDIPQSRTFSFPR
PSPAVAPKNTGPHGPQSPHQSHRGWSRRPGQKAPKHLLSPRQPPPNSPCPQPIIINAGPT
RSQGSPKSCWGDVASEWGPWNARTPILPTVASKPARDQLPVALWTSSAVLGLLLLALPTY
HLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGISPS
Download sequence
Identical sequences ENSGGOP00000020037 ENSGGOP00000003190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]