SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020042 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020042
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000635
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020042   Gene: ENSGGOG00000007797   Transcript: ENSGGOT00000024264
Sequence length 217
Comment pep:known_by_projection chromosome:gorGor3.1:2b:118183475:118319297:-1 gene:ENSGGOG00000007797 transcript:ENSGGOT00000024264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHVAYFSAFQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKV
TYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Download sequence
Identical sequences ENSGGOP00000020042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]