SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020111 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020111
Domain Number 1 Region: 565-751
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-26
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 2 Region: 142-238
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-26
Family I set domains 0.003
Further Details:      
 
Domain Number 3 Region: 222-327
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-24
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 335-431
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.024
Further Details:      
 
Domain Number 5 Region: 53-146
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 441-541
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-21
Family Fibronectin type III 0.0000259
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020111
Domain Number - Region: 5-47
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000628
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020111   Gene: ENSGGOG00000001449   Transcript: ENSGGOT00000033852
Sequence length 1462
Comment pep:known_by_projection chromosome:gorGor3.1:3:80648049:81083026:-1 gene:ENSGGOG00000001449 transcript:ENSGGOT00000033852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPSGSLFFLRIVHGRKSRPDEGIYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDV
MVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYV
CVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDD
GELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRD
QVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQ
RSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVAT
GSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAY
IEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAF
SHASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLP
TSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHG
ESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPP
QGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVI
PFLVPGIRYSVEVAASTGAGPGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAF
IAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSG
GRPGLLNISEPATQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANY
NNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLI
QSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIMEQNKLNKDYRANDTVPPTIPYN
QSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNG
EEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQS
TATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLV
SDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASE
EDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPR
PTSPVSTDSNMSAAVMQKTRPAKKPKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKT
QLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQND
GKGRGNKAAKRDLPPAKTHLIQ
Download sequence
Identical sequences ENSGGOP00000020111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]