SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020218 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020218
Domain Number 1 Region: 105-227
Classification Level Classification E-value
Superfamily POZ domain 1.1e-26
Family BTB/POZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020218   Gene: ENSGGOG00000027707   Transcript: ENSGGOT00000033916
Sequence length 530
Comment pep:known_by_projection chromosome:gorGor3.1:20:12230192:12238820:1 gene:ENSGGOG00000027707 transcript:ENSGGOT00000033916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNQFGISNSKERHTVLMVDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANKLPPVCYEI
ITLKTKKKKMAADIFPRKKPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAM
MFNNDLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDKDEIRIPDVEPA
AFLAMLKYIYCDEIDLAADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQS
CLFEEPDLTQRCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAKEIVVFEAALNW
AEVECQRQDLALSIENKRKVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFLWY
TAAKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQFAVDKRVFIAGFGL
YGSSCGSAEYSAKIELKRQGVVLGQNLSKYFSDGSSNTFPVWFEYPVQIEPDTFYTASVI
LDGNELSYFGQEGMTEVQCGKVTVQFQCSSDSTNGTGVQGGQIPELIFYA
Download sequence
Identical sequences ENSGGOP00000020218 ENSGGOP00000027718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]