SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020276 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020276
Domain Number 1 Region: 322-420
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-27
Family I set domains 0.0004
Further Details:      
 
Domain Number 2 Region: 25-119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-25
Family I set domains 0.00021
Further Details:      
 
Domain Number 3 Region: 121-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-25
Family I set domains 0.0001
Further Details:      
 
Domain Number 4 Region: 223-319
Classification Level Classification E-value
Superfamily Immunoglobulin 3.17e-23
Family I set domains 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020276   Gene: ENSGGOG00000001925   Transcript: ENSGGOT00000031548
Sequence length 519
Comment pep:novel chromosome:gorGor3.1:19:51684118:51690710:-1 gene:ENSGGOG00000001925 transcript:ENSGGOT00000031548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPTLTALLCLGLSLGPRTHVQAGPFPKPTLWAEPGSVISWRSPVTIWCQGTLEAQGYRL
HKEGSPEPWDRNNPLEPKNKARFSISSMTQHHAGRYRCRYYSSADWSEPSDPLELVVTGA
YSKPTLSALPSPVVASGGNVTLRCGSQNGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVTPSHRWRFRCYYYYTNTPQVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGES
LTLQCGSDVGYDRFVLYKEGERGFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAH
NLSSEWSAPSDPLNILIAGQFYDTVSLSVQPGPTVASGENVTLLCQSWWQFDTFLLTKEG
AAHPPLRLRSKYRAHKYQAEFPVSPVISAHTGTYRCYGSRSSDPHLLSFPSDPLELMVSG
PSGGSRLPPTGPPSTPGLGRYLEVLIGVSVAFRRQRHSKHRTSDHRKTDFQRPAGAAETE
PKDRGLLRRSGPAADVQEENLYTAVKDTQSEDRVELDSQ
Download sequence
Identical sequences ENSGGOP00000020276 ENSGGOP00000020276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]