SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020363 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020363
Domain Number 1 Region: 171-261
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 56-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000933
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 3 Region: 281-356
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000125
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020363   Gene: ENSGGOG00000002483   Transcript: ENSGGOT00000029796
Sequence length 485
Comment pep:known_by_projection chromosome:gorGor3.1:7:90440486:90477516:-1 gene:ENSGGOG00000002483 transcript:ENSGGOT00000029796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDAFMEPFGDTLGVFQCKIYLLLFDIVANCLLLRFKLSVSSYEIWKKGACSGLKVTVP
SHTVHGVRGQALYLPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHK
FTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPS
GAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNY
SCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPP
NTYSWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSI
GLEKLAQKGKSLSPLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQ
IFSGHEDALDDFGIYEFVAFPDASGVSRIPSRSVPVSDCVSGQDLHSTVYEVIQHIPAQQ
QDHPE
Download sequence
Identical sequences ENSGGOP00000002443 ENSGGOP00000020363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]