SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020373 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020373
Domain Number 1 Region: 27-110
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.57e-33
Family MHC antigen-recognition domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 113-207
Classification Level Classification E-value
Superfamily Immunoglobulin 4.85e-24
Family C1 set domains (antibody constant domain-like) 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020373   Gene: ENSGGOG00000013538   Transcript: ENSGGOT00000023958
Sequence length 255
Comment pep:known_by_projection chromosome:gorGor3.1:6:33596664:33602506:1 gene:ENSGGOG00000013538 transcript:ENSGGOT00000023958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILNKALLLGALALTAVMSPCGGEDIVADHVASCGVNLYQSYGPSGQFTHEFDGDEQFYV
DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFII
QGLRSVGASRHQGPL
Download sequence
Identical sequences ENSGGOP00000020373 ENSGGOP00000020373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]