SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020410 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020410
Domain Number 1 Region: 22-184
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.17e-36
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020410   Gene: ENSGGOG00000025685   Transcript: ENSGGOT00000030091
Sequence length 188
Comment pep:known_by_projection chromosome:gorGor3.1:6:39753724:39782575:-1 gene:ENSGGOG00000025685 transcript:ENSGGOT00000030091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSAAMAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMT
LIQKCDFPTMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYH
NGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILN
PNKMATLM
Download sequence
Identical sequences ENSGGOP00000020410 ENSGGOP00000020410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]