SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020411 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020411
Domain Number 1 Region: 459-749
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.43e-76
Family Protein kinases, catalytic subunit 0.000000289
Further Details:      
 
Domain Number 2 Region: 303-386
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-34
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 54-146
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-21
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020411
Domain Number - Region: 162-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00275
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020411   Gene: ENSGGOG00000013797   Transcript: ENSGGOT00000023592
Sequence length 929
Comment pep:known_by_projection chromosome:gorGor3.1:1:66124087:66294228:1 gene:ENSGGOG00000013797 transcript:ENSGGOT00000023592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAYKLLYLILPLSFSLPFFFFSETELSISAELVPTSSWNISSELNKDSYLTLDEPMNNIT
TSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGY
FQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVY
MESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLC
RDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPIN
KNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQ
KEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLFFFICVC
RNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGECAFGKIY
KGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAVTQEQPV
CMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAGMEYLSS
HFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPEAIMYGK
FSSESDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMYSLMTEC
WNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLSNPRYPN
YMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTGPPRVIQHC
PPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGITVFGNKSQK
PYKIDSKQASLLGDTNIHGHTESMISAEL
Download sequence
Identical sequences ENSGGOP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]