SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020493 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020493
Domain Number 1 Region: 438-687
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.11e-58
Family Eukaryotic proteases 0.0000328
Further Details:      
 
Domain Number 2 Region: 137-220
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 324-359,394-443
Classification Level Classification E-value
Superfamily Kringle-like 3.69e-17
Family Kringle modules 0.0011
Further Details:      
 
Domain Number 4 Region: 2-86
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.16e-16
Family Hairpin loop containing domain 0.017
Further Details:      
 
Domain Number 5 Region: 54-136
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000507
Family Kringle modules 0.0017
Further Details:      
 
Domain Number 6 Region: 230-315
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000265
Family Kringle modules 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020493   Gene: ENSGGOG00000010588   Transcript: ENSGGOT00000031459
Sequence length 689
Comment pep:known_by_projection chromosome:gorGor3.1:3:50971327:50975208:-1 gene:ENSGGOG00000010588 transcript:ENSGGOT00000031459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGC
QLLPWTQHSPHTRLRRSGRCDLFQKKGKWGYTPTLRNGLEENFCRNPDGDPGGPWCYTTD
PAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQ
GLDDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRG
TANTTTAAYLASVGTRKSRISTDLRQKNTRASEVGARVGTCCCGDLRENFCRNPDGSEAP
WCFTLRPGMRVAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHK
PQALTLGRHALVSGTRAWKWLRLPCYDFASAPAVHVYLRTACTTGGELLPDPDGDSHGPW
CYTMDPRTPFDYCALRRCDQVQFEKCGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQ
GQHFCGGSLVKEQWILTARQCFFSCHMPLTGYEVWLGTLFQNPQHGEPGLQRVPVAKMVC
GPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVA
LLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPN
RVCARSRWPAVFTRVSVFVDWIHKVMRLG
Download sequence
Identical sequences ENSGGOP00000020493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]