SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020498 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020498
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000111
Family ATI-like 0.047
Further Details:      
 
Domain Number 2 Region: 660-722
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000119
Family ATI-like 0.089
Further Details:      
 
Domain Number 3 Region: 768-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000157
Family ATI-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020498
Domain Number - Region: 350-398
Classification Level Classification E-value
Superfamily FnI-like domain 0.000429
Family VWC domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020498   Gene: ENSGGOG00000000463   Transcript: ENSGGOT00000026818
Sequence length 2383
Comment pep:known_by_projection chromosome:gorGor3.1:11:974686:997472:-1 gene:ENSGGOG00000000463 transcript:ENSGGOT00000026818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRWLLLSCFGALLSAGLANTSYTSPGLQRLKDSPQTAQDKGQCSTWGAGHFSTFDHHV
YDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGASVVTVSEATISVKDIGV
ISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDSHLMVLVERKYMGQMCGLCGNFD
GKVTNEFVSEEGKFLEPHKFAALQKLDDPGEICTFQDIPSTHVRQAQHARICTQLLTLVA
PECSVSKEPFVLSCQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRGPGLCSVG
QCPANQVYQECGSACLKTCSNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCV
LHGAMYAPGEVTIAACQTCRCTLGRWACTERPCPGHCSLEGGSFVTTFDARPYRFHGTCT
YILLQSPQLPENGALMAVYDKSGFSHSETTLVAVVYLSRQDKIVISQDEVVTNNGEAKWL
PYKTRNITVFRQTSTHLQMATSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDT
TDDFTTSVGIVEGTASLFVDSWRAGNCPAALERETDPCSMSQLNKVCAETHCSVLLRTGT
VFERCHATVNPAPFYKRCVYQACNYEETFPHICAALGDYVHACSSRGVLLWGWRSSVDNC
TIPCTGNTTFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNHKDECVRKAQ
CPCILEGYKFILAEQSTVINGVTCHCINGRLSCLQRAQMFLASCQAPKTFKSCSQSSENK
FGAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCVPPEECPCEFSGASYPGGA
ELHTDCSTCTCSRGRWACQQGAHCPSTCTLYGEGHVITFDGQRFVFDGNCEYILATDVCG
VNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGLSVVLADRNYTVTGEEPHVQLRVTPG
ALSLVVDISIPGRYNLTLIWNRHMTVLIRIARASQDPLCGLCGNFNGNMKDDFETRSRYV
ASSELEFVNSWKESPLCGDVSFVADPCSLNAFRSSWAERKCSIINSQTFAACHSKVYHLP
YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWRTPAFCLICTFFHTHSHSA
ESQGSGQSQRVRGAGCRGQRERVRGTGCRGQSERVRGAGLQSCYNCSQDEYFDHEEGVCV
PCMPPTTPQPPTTPQPPTTGSRPTQVWPMTGTSTTIGLLSSTGPSPSSNGTPASPTQTPL
LPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTAS
PATTSTAQSTTRTTMTLPTPATSGTSPTLRKSWRHGMPPLPKAPGPTSSSQGQARRQPKS
VGWSWRQGGPPGTHKGRPGEQRCRRAGATTRATGNQKGINFQTTTTYPTPSHPQTTLPTH
VPPFSTSLMTPNTHTVITPTHPQMATSAYIHSTPTGTIPPPTTLKATGSTHTAPPMTPTT
SGTSQASSSFNTAKTSTSLHSHNSSTHHPEVTPTSITNITLNPTSIGTWTPVAHTTSATS
SRLTTPFTTHSPPTGSSPISSTGPVTATSFHATTTYPTPSHPHTTLPTHVPPSSTSLVTP
NTHTLITPTHAQMSTSASIHSMPTGTIPPPTTIKATGSTHTAPTMTPTTSGTSQALSSFS
IAKTSTSLHSHTSSTHHPEVTPTSTTNITTKHTSTATRTPVAHTTSATSSRLTTPFTTNS
PPTGSSPISSTGPMTATSFQTTTTYPTPSHSRTTLPTHVPPSSTSLVTPNTHTLITPTHA
QMSTSASIHSTSTGTIPPPTTLKATGSTHTAPPITVTTSGTSQAPSSFSTAKTSTSLHSH
TSSTHHPEVTPTSTTNITPKHTSTATRTPLAHTTLTTSSRLTTPFTTHSPPTGSSPISST
APVTATSFQTTTTYPTPSHSQTTLPTHIPPFSTSLVTPSTQTVITPTHAQMSTSAYIHST
PTGTIPPPTTLKATGSTHTAPPMTVTTSGTSQTHSSFSTTTASSSFISSSSWLPQNSSSR
PPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSSVSYVPSSHSSPQTSSSSVGTF
SSFVSAPVHSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTL
SALLPISTLTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPT
SGFVSLTSGVTGIPTSPVTKLTTRHPGPTSSPTTRFLTSSLTAHGSTPSSAPVSSLGTPT
PTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDTRCSCCRPLHSY
EQQLELPCPDPSTPGQRLVLSQRLVLTLQVFSHCVCSSVACGD
Download sequence
Identical sequences ENSGGOP00000000458 ENSGGOP00000020498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]