SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020617 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020617
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.23e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020617   Gene: ENSGGOG00000026186   Transcript: ENSGGOT00000025013
Sequence length 290
Comment pep:known_by_projection chromosome:gorGor3.1:8:58193096:58294648:-1 gene:ENSGGOG00000026186 transcript:ENSGGOT00000025013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
TVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences G3RXT0
ENSGGOP00000020617 XP_004047118.1.27298 ENSGGOP00000020617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]