SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020643 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020643
Domain Number 1 Region: 207-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000269
Family I set domains 0.032
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000001
Family I set domains 0.0046
Further Details:      
 
Domain Number 3 Region: 297-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000118
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 107-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000199
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020643   Gene: ENSGGOG00000008900   Transcript: ENSGGOT00000028810
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:1:136745288:136766069:-1 gene:ENSGGOG00000008900 transcript:ENSGGOT00000028810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSLLVIFGEFNNLTDSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSV
FKKLSDFLIQSAVLSDSGNYFCSTKGQLLFWDKTSNIVKIKVQELFQHPVLTASSFQPIE
GGPVSLKCETRRSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCEAE
TVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWY
REATGTSMGKKTQRSLSADLEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
VLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTA
EHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALMLYA
LFHKISGESSATDEPRGASRPNPQEFTYSSPTPDMEELQPVYVNVGSVDVDVVYSXXXXX
XXXXXXXNIRTLLENKDSQVIYSSVKKS
Download sequence
Identical sequences ENSGGOP00000020643 ENSGGOP00000008703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]