SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020665 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020665
Domain Number 1 Region: 21-61
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-16
Family V set domains (antibody variable domain-like) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020665   Gene: ENSGGOG00000022923   Transcript: ENSGGOT00000024904
Sequence length 61
Comment pep:novel chromosome:gorGor3.1:16:34092703:34092969:-1 gene:ENSGGOG00000022923 transcript:ENSGGOT00000024904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWTCKILFLVAAATGAHFLVQLVQSGAEVKKPGASVKVSCKASGYTFTYCYLHWVRWAP
G
Download sequence
Identical sequences ENSGGOP00000020665 ENSGGOP00000026397 ENSGGOP00000026397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]