SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020670 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020670
Domain Number 1 Region: 104-191
Classification Level Classification E-value
Superfamily Histone-fold 7.05e-34
Family TBP-associated factors, TAFs 0.0000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020670   Gene: ENSGGOG00000023773   Transcript: ENSGGOT00000022422
Sequence length 200
Comment pep:novel chromosome:gorGor3.1:17:76244980:76245582:-1 gene:ENSGGOG00000023773 transcript:ENSGGOT00000022422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPMETGRQRDASAEMFAMPRGLKGSNKDGIPEELDGNLEEPRDQESELRSQDVMDLTEGD
NEASASAPPAAKRQKTDTKGKKERKPTVDAEEAQRMTTLLSAMSEEQLARYEVCRRSAFP
KARIAALMQSITGRSVSENTAIAMAGIAKVFVGEVVEEALDVCEMWGEVPPLQPKHLREA
VRRLKPKGLFPNSNYKKIMF
Download sequence
Identical sequences ENSGGOP00000020670 ENSGGOP00000020670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]