SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020681 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020681
Domain Number 1 Region: 36-267
Classification Level Classification E-value
Superfamily L domain-like 7.74e-44
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 259-365
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-16
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020681   Gene: ENSGGOG00000014343   Transcript: ENSGGOT00000025800
Sequence length 485
Comment pep:known_by_projection chromosome:gorGor3.1:8:144763132:144766667:-1 gene:ENSGGOG00000014343 transcript:ENSGGOT00000025800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSLLLKLGSLFLKPDPSLPIRAAGCPAACRCYSATVECGALRLRVVPLGIPPGTQTLFL
QDNNIARLEPGALAPLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRGGA
FVGLAQLRVLYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDL
SRNQLGTISREALQPLASLQVLRLTENPWRCDCALHWLGAWIKEGGQRLLTSRDRKIMCA
EPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRKVP
QPREGRPRAQAQLEGGLLGLGGQSASDTGSGMLFLSNITLAHAGKYECEASNAGGAARVP
FRLLVNASRQQPQQPASMAFRALGLATQTAIAAAIALLALTALLLVAMICRRRRRRKKAR
GPPGEGALFVNDYLDGPCTFAQLEELRDERGHEMFVINRSKPLFADGPAEAPADCGPAVA
YEIHC
Download sequence
Identical sequences ENSGGOP00000020681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]