SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020693
Domain Number 1 Region: 560-620
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000229
Family BSTI 0.021
Further Details:      
 
Domain Number 2 Region: 717-800
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000251
Family VWC domain 0.035
Further Details:      
 
Domain Number 3 Region: 809-868
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000732
Family VWC domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020693   Gene: ENSGGOG00000023813   Transcript: ENSGGOT00000033199
Sequence length 1001
Comment pep:known_by_projection chromosome:gorGor3.1:11:1129202:1138738:1 gene:ENSGGOG00000023813 transcript:ENSGGOT00000033199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGCPVTSTPVTAPSTPSGRATSPTQSTSSWQKSRTNTVVTTSTTSTPQTSTTSAPTTSTT
SAPTARTTSAPTTSTTSTPQTSTTSAPTTSTIPASTPSTTSAPTTSTIPASTPSTTSAPT
TSTIPASTPSTTSAPTTSTTSVAYSTQTCFCNVADRLYPAGSIIYRHRDLAGHCYYALCS
QDCQVVRGVDSDCPSTTLPPAPATSPSTSTSEPVTELGCPNAVPPRKKGETWATPNCSEA
TCEGNNVISLRPRTCPRVEKPTCANGYPAVKVADQDGCCHHYQCQCVCSGWGDPHYITFD
GTYYTFLDNCTYVLVQQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRK
PVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGIKMYATIPELGVQVMFSGLIFSVEVPFS
KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLNKWMMPSGPPPPAPKHTECVEG
ACPGIQEGGHTPVAALGLTSVFEPCHTVIPPLPFYEGCVFDRCHMTDLDVVCSSLELYAA
LCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEG
CFCPEGMTLFSTSAQVCVPMGCPRCLGPHGEPVKVGHTVGMDCQECTCEVATWTLTCRPK
LCPLPPACPLPGFVPVPAAPQAGQCCPQYSCACNTSRCPAPVGCPEGARAIPTYQEGACC
PVQNCSWTVCSINGTLYQPGAVVSSSLCETCRCELPGGPPSDAFVVSCETQICNTHCPVG
FEYQEQSGQCCGTCVQVACVTNTSKSPAHLFYPGETWSDPGNHCVTHECEKHRDGLVVVT
TKKACPPLSCSLDKARMSKDGCCRFCPPPPPPYQNQSTCAVYHRSQIIQQQGCSSSEPVR
LAYCRGNCGDSFSMYSLEGNMVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECG
CMGRRCPAPGDTQHSEEAEPEPSPEAESGSWERGVPVSPIH
Download sequence
Identical sequences ENSGGOP00000020693 ENSGGOP00000020693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]