SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020804 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020804
Domain Number 1 Region: 19-120
Classification Level Classification E-value
Superfamily POZ domain 3.73e-29
Family Tetramerization domain of potassium channels 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020804   Gene: ENSGGOG00000027855   Transcript: ENSGGOT00000023167
Sequence length 276
Comment pep:known_by_projection chromosome:gorGor3.1:4:44879870:44880796:-1 gene:ENSGGOG00000027855 transcript:ENSGGOT00000023167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPISEMVSSSSCAPSPFPEVVELNVGGQVYVTKHSTLLSVPDSTLASMFSPSSPQLPRDS
RARFFIDRDGFLFRYVLDYLRDKQLALPEHFPEKERLLREAEYFQLTDLVKLLSPKVTKQ
NSLNDEGCQSDLEDNVSQGSSDALLAHGGGGGGSAQDKRSGFLTLGYRGSYTTVRDNQAD
AKFRRVARIMVCGRIALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEA
GFHMVACNSSGTAAFVNQYRDDKIWSSYTEYIFFRK
Download sequence
Identical sequences ENSGGOP00000020804 ENSGGOP00000020804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]