SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020805 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020805
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.01e-36
Family beta-lactamase inhibitor protein-II, BLIP-II 0.075
Further Details:      
 
Domain Number 2 Region: 278-358
Classification Level Classification E-value
Superfamily POZ domain 0.0000000173
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020805   Gene: ENSGGOG00000024844   Transcript: ENSGGOT00000031582
Sequence length 424
Comment pep:novel chromosome:gorGor3.1:10:101863736:101865033:-1 gene:ENSGGOG00000024844 transcript:ENSGGOT00000031582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTNCCGCLRIGNTQSTIKPRRLDSLSGKKIASLSCGSSIHIVLAIEEEVFTWHNVYSQLG
SGTTNHGFSTNLSNKIEVAYGSHHSLALISDGQVFAWGYSNSRHVRYGSTVNQPIAQGVT
GCLRNKEAVNTACGQVCSMVAVDTGEATCAYRHTLVLTDEGQVYAWGANYGQLGTGNKSN
HSYPTFVIVEKDRIIEIAVCHSSHTSAAKTQGGRVYIWGQGQLMIFPHLTHVCTDDTFTC
FAAPAIHGASSLWNLMTTLAVAELLKREFDNLDTAVLKFVVSGKYIYAHKVLKDVCEHVH
SLLEGNEDVIVEMSEFSYSVYWAFLEYLHTNSISLSPQEAVGLQDLATFYKENHLKKALP
AIKQGIHEQSAVPLLSAVVKYDAWDLEEFCFRFCINHLTIVTNMNYDLLKNFIRKESRVK
AFKN
Download sequence
Identical sequences ENSGGOP00000020805 ENSGGOP00000020805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]