SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020866 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020866
Domain Number 1 Region: 41-320
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.42e-98
Family Inorganic pyrophosphatase 0.000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020866   Gene: ENSGGOG00000016995   Transcript: ENSGGOT00000030827
Sequence length 324
Comment pep:known_by_projection chromosome:gorGor3.1:10:82725738:82746065:-1 gene:ENSGGOG00000016995 transcript:ENSGGOT00000030827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGPVLAVRRRGALSLSVGAVCGLVALGQWRRQDSGTMNGFSTEERAAPFSLEYRVFLKN
EKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVAN
LFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCPRGEIIGVKVLGI
LAVTDEGETDWNVIAINMDDPDAANYNDINDVKRLKPGYLEATVDRRYKFPEGKPEHEFA
FNAEFKDKDFAVDIIKSTHDHWKTLVTKKTNGKGISCMNTTVSESLFKCDPDAARAIVDA
LPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences ENSGGOP00000020866 ENSGGOP00000020866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]