SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020882 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020882
Domain Number 1 Region: 291-385
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.18e-32
Family MMLV matrix protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 156-243
Classification Level Classification E-value
Superfamily Immunoglobulin 2.5e-17
Family C1 set domains (antibody constant domain-like) 0.0069
Further Details:      
 
Domain Number 3 Region: 36-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000185
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020882   Gene: ENSGGOG00000022788   Transcript: ENSGGOT00000026752
Sequence length 453
Comment pep:known_by_projection chromosome:gorGor3.1:11:17570527:17591060:1 gene:ENSGGOG00000022788 transcript:ENSGGOT00000026752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRAAASTCAALLILLWALTTAGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITS
MGITWFWKSLTFDKEVKIFEFFGDHQEAFRRGAIVSPWRLKSGDASLQLPGIQLEEAGEY
RCEVVVTPLKAQGTVQLEVVASPASRLFLDQVGVKENEGKYMCESSGFYPEAINITWEKQ
TQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVWHASLHTPLR
SNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIVLISWKKICNKSSAYTPLKCI
LKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQLDVFCRQEGKW
SEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSAKSEKQTPREHSDAVPDAP
ILLVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ
Download sequence
Identical sequences G3RYJ3
ENSGGOP00000020882 ENSGGOP00000020882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]