SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020892 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020892
Domain Number 1 Region: 122-271
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-42
Family Mannose 6-phosphate receptor domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 275-419
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-41
Family Mannose 6-phosphate receptor domain 0.000000672
Further Details:      
 
Domain Number 3 Region: 579-714
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-39
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1478-1609
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-37
Family Mannose 6-phosphate receptor domain 0.000000104
Further Details:      
 
Domain Number 5 Region: 1328-1469
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.06e-36
Family Mannose 6-phosphate receptor domain 0.00056
Further Details:      
 
Domain Number 6 Region: 715-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-33
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 7 Region: 428-570
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-32
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1184-1325
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.28e-31
Family Mannose 6-phosphate receptor domain 0.00015
Further Details:      
 
Domain Number 9 Region: 1-119
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-30
Family Mannose 6-phosphate receptor domain 0.000000998
Further Details:      
 
Domain Number 10 Region: 1614-1759
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.11e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2095-2242
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1966-2093
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-28
Family Mannose 6-phosphate receptor domain 0.00075
Further Details:      
 
Domain Number 13 Region: 1029-1145
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 8.9e-24
Family Mannose 6-phosphate receptor domain 0.0046
Further Details:      
 
Domain Number 14 Region: 886-1030
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-21
Family Mannose 6-phosphate receptor domain 0.0046
Further Details:      
 
Domain Number 15 Region: 1766-1859,1908-1951
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-20
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 16 Region: 1858-1907
Classification Level Classification E-value
Superfamily Kringle-like 1.97e-16
Family Fibronectin type II module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020892   Gene: ENSGGOG00000001658   Transcript: ENSGGOT00000027820
Sequence length 2454
Comment pep:known_by_projection chromosome:gorGor3.1:6:161193408:161309075:1 gene:ENSGGOG00000001658 transcript:ENSGGOT00000027820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSYTWEAVDTKNNVLYKINICGSVDIVQCGPSSAVCMHDLKTRAYHSIGDSVLRSATRS
LLEFNTTVSCDQQGTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFK
ANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRA
CPPGTAACLVRGYQAFDVGQPQDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFV
CPSERREGTIPKLTAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQS
GGSSYISDGKEYLFYLNVCGETEIQFCNKKQAAVCQVKRSDTSQVKAAGRYHNQTLRYSD
GDLTLIYFGGDECSSGFQRMSVINFECNKTADNDGKGSPVFTGEVDCTYFFTWDTEYACV
KEKEDLLCGATDGKKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGK
ARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCK
PGDLESAPVLRTSGEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKN
GAYKVETKKYDFYINVCGPVSVSPCQADSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQL
NYRGGTPYNNERHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLEC
VVTDPSTLEQYDLSSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYA
SACQMKYEKDQGSFTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTT
RIHLVCSRGRLNSHPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNL
NPLNSSQGYNVSGIGKIFVFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGI
EKSLQLSTEGFITLTYKGPLSAKGTADAFIIRFVCNDDVYSGPLKFLHQDIDSGQGIRNT
YFEFETALACVPSPVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNP
LPYIPGCHGSAVGSCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRIT
FECAQISFARGGQRLGTNCGYHLFFLLENVNACVVAVALHFFHVLEGDNCEVKDPRHGNL
YDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDESKVVSSCQEKREPQGFHKVAGL
LTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDRGTQQPVFLKETSDCSYLFEWRT
QYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGT
EPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCS
ESQVNSRPMFISAVEDCEYTFAWPTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAG
FTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSP
CPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNG
SSIVDLSPLIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPI
DGPPIDIGRVAGPPILNPIANEIYLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGMPKL
LRTSECDFVFEWETPIVCPDEVRMDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVG
VCTFAVGPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPET
DDGIPCVFPFIFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKC
DEDEDIGRPQVFSEVRGCDVTFEWKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSL
VHDGVSYYINLCQKIYKGPLGCSERASICRRTTAGDVQVLGLVHTQKLGVIGDKVVVTYS
KGYPCGGNKTASSVIELTCTKTVGRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNG
TITNPINGKSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVK
PNDQHFSRKVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIP
EFSHETADCQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVAL
TCCLLALLLYKKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLP
PPRQGKEGQENGHITTKSVKALSSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRN
AQSNALQEREDDRVGLVRGEKARKGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSGGOP00000020892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]