SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020934 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020934
Domain Number 1 Region: 256-338
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-19
Family C1 set domains (antibody constant domain-like) 0.015
Further Details:      
 
Domain Number 2 Region: 146-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000134
Family C1 set domains (antibody constant domain-like) 0.028
Further Details:      
 
Domain Number 3 Region: 34-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000139
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020934   Gene: ENSGGOG00000022094   Transcript: ENSGGOT00000024581
Sequence length 508
Comment pep:known_by_projection chromosome:gorGor3.1:20:1913488:1959945:1 gene:ENSGGOG00000022094 transcript:ENSGGOT00000024581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPEKSVLVAAGETATLRCTATSL
IPVGPIQWFRGAGPSRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI
TLKWFKNGNQLSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL
RGTANLSEAIRVPPTLEVTQQPLRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS
TLTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT
AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI
TQVQSLDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMV
HLNRTPKQPAPKPEPSFSEYASVQVPRK
Download sequence
Identical sequences ENSGGOP00000020934 ENSGGOP00000020934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]