SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021052 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021052
Domain Number 1 Region: 265-363
Classification Level Classification E-value
Superfamily Immunoglobulin 2.92e-24
Family I set domains 0.0063
Further Details:      
 
Domain Number 2 Region: 82-169
Classification Level Classification E-value
Superfamily Immunoglobulin 2.92e-19
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 
Domain Number 3 Region: 363-518
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-18
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 4 Region: 180-278
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000137
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 2-68
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000227
Family I set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021052   Gene: ENSGGOG00000027259   Transcript: ENSGGOT00000024551
Sequence length 613
Comment pep:novel chromosome:gorGor3.1:1:132773588:132780380:1 gene:ENSGGOG00000027259 transcript:ENSGGOT00000024551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLVLPCQVEGEPPVSISWQRDGLALANESGVTLMPDGSLHLAALPSRRSLPSRAHEYHCV
AQNRYGRLVSRRARVQLASLSRFHQHPESIEVERGGAARFQCLIQGVPELSISWEHNGTA
LNTANHRVTLLPSGILHITSVSQTDVGTYRCVARNVASTRHSQDTQLTLSGNGGAWHKEP
ENLSGPQNLNLTVHQTAVLECIATSHPWPLVSWSCLDGRSIGVEGIQVLGTGNLMISDVS
VQHSGVYVCAANRPGTRVRRTAQGVLLVQELPEFVQWPQSLSKPPGSSAIFTCVAQGVPE
PRLVWLKNGKMLSPGNNIRLTHNNSTLMLAGVSVEDEAIYQCVAENSKGTNQASARLVVT
GGPPPSRDIIGYVLHLQPEPSGPELQEAVSKGTSEHVFSNLEPATAYAIHLRAYSAEGAS
QDSAPIFASTMDSTPAALGFSTKVLNATSVQASWELPPQLGPIQGFKFHRKLPAAHFEGP
LLLASSVSSFLYTDLEPAALYEIKLQAFNGNGDGNSSARFVSLRDVPLATPESKTGCSCS
QGESSPLPGVVVGIHVGLAALIVCLLCLFLGWRHRETVCITVAQGQREQKSPFFSELCGT
RGRRRPAMSREER
Download sequence
Identical sequences ENSGGOP00000021052 ENSGGOP00000021052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]