SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021096 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021096
Domain Number 1 Region: 40-145
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-19
Family V set domains (antibody variable domain-like) 0.00032
Further Details:      
 
Domain Number 2 Region: 161-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000118
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 
Domain Number 3 Region: 383-459
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000968
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 281-361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000645
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021096   Gene: ENSGGOG00000023573   Transcript: ENSGGOT00000033978
Sequence length 513
Comment pep:novel chromosome:gorGor3.1:19:47316810:47320275:1 gene:ENSGGOG00000023573 transcript:ENSGGOT00000033978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGQAQPQSPEMLLLPLLLLPLLLPVLAVGSLNKDPSYSLQVQRQVPVPEGLCVIVSCN
LSYPRDGWDESTAAYGYWFKGRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCS
LVIRDAQREDEAWYFFRVERGSRVRHSFVNNAFSVSVPALTQKPDVYIPETLEPGQPVTV
ICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHFSVLSFTPSPQDHDTDLTCHVDFSRK
GVSAQRTVRLRVAYAPKDLIISISHDDTSALELQENVIYLEVQKGQFLRLLCAADSQPPA
TLSWVLQDRVLSSSHPWGPRTLGLELRGVKAGDSGRYTRRAENRLGSQQRALDLSVQYPP
ENLRVMVSQANRTVLENLGNGTSLRVLEGQSLRLVCVTHSSPPARLSWTQRGQILSPSQP
SDPGVLELPRVQMEHEGEFTCHAGHPLGSQRVSLSFSVHCSGPMTGVVLVAVGEVAMKIL
LLYFCLILLRVRSCRRKAARAALGMEASDTVTD
Download sequence
Identical sequences ENSGGOP00000021096 ENSGGOP00000021096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]