SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021135 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021135
Domain Number 1 Region: 62-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000105
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 135-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000592
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021135   Gene: ENSGGOG00000012761   Transcript: ENSGGOT00000032126
Sequence length 290
Comment pep:known_by_projection chromosome:gorGor3.1:3:111626825:111653744:1 gene:ENSGGOG00000012761 transcript:ENSGGOT00000032126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDE
REQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQL
GLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNIT
CSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHL
GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
Download sequence
Identical sequences ENSPTRP00000043714 9598.ENSPTRP00000043714 ENSPTRP00000043714 ENSGGOP00000021135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]