SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021288 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021288
Domain Number 1 Region: 32-122
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-25
Family V set domains (antibody variable domain-like) 0.0000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021288   Gene: ENSGGOG00000025601   Transcript: ENSGGOT00000030336
Sequence length 123
Comment pep:known_by_projection chromosome:gorGor3.1:7:141004785:141005280:1 gene:ENSGGOG00000025601 transcript:ENSGGOT00000030336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMRSWPGPEMGTRFFFYVALCLLWTGHMDAGITQSPRHKVTEIGTPVTLRCHQTENHRYM
YWYRQDPGHGLRLIHYSYGVKDTDKGEVSDGYSVSRSKTEDFLLTLESATSSQTSVYFCA
ISE
Download sequence
Identical sequences ENSGGOP00000021288 ENSGGOP00000021288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]