SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021296 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021296
Domain Number 1 Region: 41-196
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.08e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000446
Further Details:      
 
Domain Number 2 Region: 201-368
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 4.55e-35
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021296   Gene: ENSGGOG00000014018   Transcript: ENSGGOT00000029540
Sequence length 449
Comment pep:known_by_projection chromosome:gorGor3.1:7:154457935:154467339:-1 gene:ENSGGOG00000014018 transcript:ENSGGOT00000029540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLPAAHLLFVAPHNDSATGEPEASSGSGPPSGG
ALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILIN
RVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDVALPAPGAADAPGAGATAGIH
WYSQLLYQIGTWLLDSEALHPLGMAVKSS
Download sequence
Identical sequences ENSGGOP00000021296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]