SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021335 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021335
Domain Number 1 Region: 88-279
Classification Level Classification E-value
Superfamily Cytochrome c 2.25e-74
Family Cytochrome bc1 domain 0.00000000969
Further Details:      
 
Domain Number 2 Region: 280-325
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00000000000000111
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021335   Gene: ENSGGOG00000010506   Transcript: ENSGGOT00000030850
Sequence length 325
Comment pep:known_by_projection chromosome:gorGor3.1:8:144275891:144278722:1 gene:ENSGGOG00000010506 transcript:ENSGGOT00000030850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAALQAALSLEVLNLQGQPPPGHRAACLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNENGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYIFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences ENSGGOP00000010250 ENSGGOP00000021335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]