SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021338 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021338
Domain Number 1 Region: 43-165
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000627
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 183-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000638
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021338   Gene: ENSGGOG00000007810   Transcript: ENSGGOT00000029402
Sequence length 326
Comment pep:known_by_projection chromosome:gorGor3.1:18:43378298:43384752:1 gene:ENSGGOG00000007810 transcript:ENSGGOT00000029402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPWRMVCQRWVRAVGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLP
CTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRN
DLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPGLAHAF
RALCTAEGEPPPALAWSGPALGNSLAAVRSPGEGHGHLVTAELPALTHDGRYTCTAANSL
GRSEASVYLFRFHGASGASTVALLLGALGLKALLLLGVIQACSLAVPPTEHLDTPDTPPR
SQAQESNYENLSQMNPRSPPATMCSP
Download sequence
Identical sequences ENSGGOP00000021338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]