SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021386 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021386
Domain Number 1 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000803
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 128-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000268
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021386   Gene: ENSGGOG00000028333   Transcript: ENSGGOT00000029586
Sequence length 172
Comment pep:known_by_projection chromosome:gorGor3.1:19:53158373:53160916:1 gene:ENSGGOG00000028333 transcript:ENSGGOT00000029586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANG
VPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH
Download sequence
Identical sequences A0A2J8R3J8 A0A2K5BW92 A0A2K5PJZ8 A0A2K6S2N1 G3RZZ3 H2QH74 Q9UK33
ENSP00000320050 9598.ENSPTRP00000019811 9606.ENSP00000320050 gi|254540128|ref|NP_001156895.1| gi|46361970|ref|NP_996998.1| gi|7705881|ref|NP_057286.1| ENSGGOP00000021386 ENSGGOP00000021386 ENSPTRP00000019811 NP_001156895.1.87134 NP_001156895.1.92137 NP_057286.1.87134 NP_057286.1.92137 NP_996998.1.87134 NP_996998.1.92137 XP_003316742.1.37143 XP_010330969.1.74449 XP_012320724.1.9421 XP_016792399.1.37143 XP_017402102.1.71028 XP_018871524.1.27298 XP_018871525.1.27298 XP_018871526.1.27298 ENSP00000320050 ENSP00000443957 ENSP00000446126 ENSP00000320050 ENSP00000443957 ENSP00000446126 ENSPTRP00000019811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]