SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021437 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021437
Domain Number 1 Region: 731-822
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000145
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 10-53
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000049
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021437   Gene: ENSGGOG00000006729   Transcript: ENSGGOT00000023687
Sequence length 862
Comment pep:known_by_projection chromosome:gorGor3.1:12:63491625:63570553:1 gene:ENSGGOG00000006729 transcript:ENSGGOT00000023687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNVRPVSGDLSYLRTPGGLCRISASGPESLLAGSKVLLGFSSDESDVEASPR
DQAGGGGRKDRASLQYRGLKAPPAPLAASEVTNSNSAERRKPHSWWGARRPAGPELQTPP
GKDGAPLWASRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRPRRTHS
KPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDS
SPVPRYRVNAKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLP
PSAAVAASSSLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAH
YLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTL
YKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGI
RCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRY
MKYRWTKEEEETRQMYDMVVKIIVLDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDR
KKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQA
FHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNS
REGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSN
KHMNSMSHLRLRTGLTNSQGSS
Download sequence
Identical sequences ENSGGOP00000021437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]