SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021447 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021447
Domain Number 1 Region: 36-140
Classification Level Classification E-value
Superfamily Immunoglobulin 7.35e-24
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 
Domain Number 2 Region: 144-233
Classification Level Classification E-value
Superfamily Immunoglobulin 4.93e-17
Family I set domains 0.0054
Further Details:      
 
Domain Number 3 Region: 237-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-16
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021447   Gene: ENSGGOG00000010044   Transcript: ENSGGOT00000028726
Sequence length 320
Comment pep:novel chromosome:gorGor3.1:19:38880909:39077422:1 gene:ENSGGOG00000010044 transcript:ENSGGOT00000028726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSARPHRECIPWQGLLLIASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPE
NLYSYGWYKGKTVEPNQLIAAYVTDTHVRTPGPAYSGRETISPNASLLIQNVIQNDTGFY
TLQVIKSDLVNEEATGQFRVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWV
NGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVP
TISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ
AHNSATGLNRTTVTMITVSG
Download sequence
Identical sequences ENSGGOP00000021447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]