SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021523 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021523
Domain Number 1 Region: 79-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000746
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 162-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000772
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021523
Domain Number - Region: 127-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021523   Gene: ENSGGOG00000027644   Transcript: ENSGGOT00000025703
Sequence length 205
Comment pep:novel chromosome:gorGor3.1:1:55743483:55752713:1 gene:ENSGGOG00000027644 transcript:ENSGGOT00000025703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPQGENGYAAAEPKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTIL
GLPSRTPGAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSL
PHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDC
IPRHLCRDHVQHCSDWSDEYACPGP
Download sequence
Identical sequences G3S0C9
ENSGGOP00000010433 ENSGGOP00000021523 ENSGGOP00000010433 ENSGGOP00000021523 XP_004025892.1.27298 XP_004025893.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]