SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021524 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021524
Domain Number 1 Region: 1934-2078
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-42
Family C-type lectin domain 0.000000351
Further Details:      
 
Domain Number 2 Region: 380-486
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-42
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 150-259
Classification Level Classification E-value
Superfamily C-type lectin-like 1.44e-39
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 490-603
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-30
Family Link domain 0.0045
Further Details:      
 
Domain Number 5 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000669
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 6 Region: 2079-2139
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021524   Gene: ENSGGOG00000005262   Transcript: ENSGGOT00000028137
Sequence length 2164
Comment pep:known_by_projection chromosome:gorGor3.1:15:68614009:68652992:1 gene:ENSGGOG00000005262 transcript:ENSGGOT00000028137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPTDATLEI
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVI
LTVKPIFEVSPSPLEPEEPFTFAPEIGATAFPEVENETGEATRPWGFPTPGLGPATAFTS
EDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYE
AGYEQCDAGWLQDQTVRYPIVSPRTPCVGDKNSSPGVRTYGVRPSTETYDVYCFVDRLEG
EVFFATRLEQFTFQEALEFCESHNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVT
PRPACGGDKPGVRTVYLYPNQTGLPDPLSRHHAFCFRGISVVPSPGEEEGGTPTSPSGVE
EWIATQVVPGVAAVPAEEETTAVPSRETTAILEFTTEPENQTEWEPAYTPVGTSPLPGIL
PTWPPTGAATEESTEGPSATEVPSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELF
PSEEPFPSKEPSPSEEPSASEEPYTPLPPVPSWTELPSSGEESGAPDVSGDFIGSGDVSG
HLDFSGQLSGDRASELPSGDLDSSGLTSTVGSGLPVESGLASGDEERIEWSSTPTVGELP
SGAEILEGSASGVGDLSGLPSGEVLETSAFGVGDLSGLPSGEVLETTAPGVEDISGLPSG
EVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETIEEISGLPSGEVLETTA
PGAEEISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGV
EEISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVEEISGLPSGEVLETTAPGVEDI
SRLPSGEVLETSTSAVGDLSGLPSGGEVLEISASGVEDISISGLPSGEVVETSASGIEDV
SELPSGEGLETSASGVEDLSRLPSGEEVLEISASGVGDLSGLPSGGEGLETSASEVGTDL
SGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLDLGKLPSGTLGSGQAPETSDLP
SGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDSTLVEVVTASTASELEGRGTIGI
SGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDVSGEIPGLFGVSGQPSGFPDTS
GETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITGLSGETSGVPDLSGQPSGLPGFS
GATSGVPDLVSGATSGSGESSGITFVDTSLVEVAPTTFKEEEGLGSVELSGLPSGEADLS
GKPGMVDVSGQFSGTVDSSGFTSQTPEFSGLPSGIAEVSGESSRAETGSSLPSGAYYGSG
TPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELSGAHSGAPDMSGEHSGFLDLSG
LQSGLVEPSGEPPGTPYFSGDFASTTNVSGESSVAMGTSGEASGLPEVTLITSEFVEGVT
EPTISQELGQRPPVTHTPQLFESSGEVSTAGDVSGATPVLPGSGVEVSSVPESSSETSAY
PEAGFGASAAPEASREDSGSPDLSETTSAFHKADLERSSGLGVSGSTLTFQEGEASAAPE
VSGESTTTNDMGTEAPGLPSATPTASGDRTEISGDLSGHSSRLGVVISTSIPESEWTQQT
QRPAETHLEIESSSLLNSGEETHKVETATSPTDASIPASPEWKRESESTAAAPARSCAEE
PCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWNKYQGHCYRHFPDRETWVDAER
RCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFENWRPNQP
DNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPVVEHARTFGQKKDRY
EINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPRITCTDPTTYKRRLQKRSSRHPRRSRP
STAH
Download sequence
Identical sequences ENSGGOP00000021524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]