SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021539 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021539
Domain Number 1 Region: 360-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-79
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 202-308
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-32
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 4.19e-20
Family Fibronectin type II module 0.0036
Further Details:      
 
Domain Number 4 Region: 97-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000288
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021539
Domain Number - Region: 133-168
Classification Level Classification E-value
Superfamily FnI-like domain 0.0628
Family Fibronectin type I module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021539   Gene: ENSGGOG00000009659   Transcript: ENSGGOT00000024582
Sequence length 618
Comment pep:known_by_projection chromosome:gorGor3.1:5:162001255:162008637:-1 gene:ENSGGOG00000009659 transcript:ENSGGOT00000024582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGCLLVSLESTLSIPPWKAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQQWGYCLEPKKVKADHCSKHSPCQKGGTCVNTPSGPHC
LCPQHLTGNHCQKEKCFEPQLLRFFHENEIWYRTEQAAVARCQCKGPDAHCQRLASQGKS
VRKTGWQEAGWCAGKESSLRGHCPVGYTGPFCDVDTKASCYDGRGLSYRGLARTTLSGAP
CQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQT
PTQAAPPTPVSSRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPL
SCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDR
PAPEDLTVVLGQERHNHSCEQCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCAL
LSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPLLSLERCSAPDV
HGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPG
VYTDVAYYLAWIREHTVS
Download sequence
Identical sequences ENSGGOP00000021539 ENSGGOP00000009440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]