SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021575 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021575
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 7.46e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 99-147
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000432
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021575   Gene: ENSGGOG00000003388   Transcript: ENSGGOT00000029670
Sequence length 446
Comment pep:known_by_projection chromosome:gorGor3.1:12:97700616:97734291:1 gene:ENSGGOG00000003388 transcript:ENSGGOT00000029670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGTNSK
GPPDFSSDEEREPTPVLGCRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYG
VNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEE
DSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTR
ESTRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPI
LPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISASCRRPIK
GAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLFVVVAVFLF
LVYQAMETNQVNPFSNFLHVDPRKSN
Download sequence
Identical sequences ENSGGOP00000021575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]