SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021604 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021604
Domain Number 1 Region: 65-159
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-24
Family V set domains (antibody variable domain-like) 0.00061
Further Details:      
 
Domain Number 2 Region: 359-448
Classification Level Classification E-value
Superfamily Immunoglobulin 5.68e-17
Family I set domains 0.0068
Further Details:      
 
Domain Number 3 Region: 177-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000185
Family I set domains 0.0062
Further Details:      
 
Domain Number 4 Region: 272-338
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000711
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021604   Gene: ENSGGOG00000010966   Transcript: ENSGGOT00000033290
Sequence length 448
Comment pep:known_by_projection chromosome:gorGor3.1:19:40061986:40072261:-1 gene:ENSGGOG00000010966 transcript:ENSGGOT00000033290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRTAQLRAVLRKFLDPRLISTEENTQAAETMGPLSAPPCTQRIAWKGLLLTASLLNFWNP
PTTAQVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKGQMTDLYHYITSYVVDGQIII
YGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGNFTFTLYLETPKPS
ISSSNLNPREAMETVILNCDPETPDASYQWWMNGQSLPMTRRFQLSETNRTLFLFGVTKY
TAGPYECEIQKSGSASRSDPVTLNLLHGLDAITISSSYTYYHTGEVPKLSCLTDSHPLAE
HSWLIDGKFQQSAQVFFIPQFTKTYTGVYVCFIHNSATGGTNLIIKRIIVPRLSPPTELP
KPSISSNNSNPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNV
TRNDAGAYVCGIQNSVSANRSDPVTLDV
Download sequence
Identical sequences ENSGGOP00000021604 ENSGGOP00000021604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]