SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021633 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021633
Domain Number 1 Region: 122-227
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 310-378
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 24-127
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 224-308
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000233
Family I set domains 0.041
Further Details:      
 
Domain Number 5 Region: 397-500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000757
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021633   Gene: ENSGGOG00000028053   Transcript: ENSGGOT00000027209
Sequence length 708
Comment pep:known_by_projection chromosome:gorGor3.1:19:33156834:33167721:1 gene:ENSGGOG00000028053 transcript:ENSGGOT00000027209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMRVPALLVLLFCFRGSAGPSPHFLQQPEDLVVLLGEEARLPCALGAYWGLVQWTKSG
LALGGQRDLPGWSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVL
VPPEAPQVLGGPSVSLVAGVPANLTCRSRGHARPTPELLWFRDGVLLDGTTFHQTLLKEG
TPGSVESTLTLTPFSHDDGATFVCRARSQALPAGRDTAITLSLQYPPEVTLSASPHTVQE
GEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVAEASFLTEPVSCEVSNAVGSA
NRSTALDVLFGPILQAKPEHVSVDVGEDASFSCAWRGNPLPRVTWTRRGGAQVLGSGATL
RLPSVGPEDAGDYVCRAEPGLSGLGGGAAEARLTVNAPPVVTALHSAPAFLRGPARLQCL
VFASPAPDAVVWSWDEGFLEAGSQGRFLVETFPAPESRGGLGPGLISVLHISGTQESDFS
RSFNCSARNRLGEGGAQASLGRRDLLPTVRIVAGVAAATTTLLMVITGVALCCWRHSKAS
ASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPT
NGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAG
YLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV
Download sequence
Identical sequences A0A2I2ZVC6
ENSGGOP00000021633 ENSGGOP00000021633 XP_004060597.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]