SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021662 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021662
Domain Number 1 Region: 594-652
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000343
Family BSTI 0.039
Further Details:      
 
Domain Number 2 Region: 979-1038
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000703
Family BSTI 0.055
Further Details:      
 
Domain Number 3 Region: 1368-1427
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000719
Family ATI-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021662
Domain Number - Region: 2086-2127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021662   Gene: ENSGGOG00000010060   Transcript: ENSGGOT00000033960
Sequence length 2156
Comment pep:known_by_projection chromosome:gorGor3.1:11:119079277:119166459:1 gene:ENSGGOG00000010060 transcript:ENSGGOT00000033960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSFLRIWVSFIFALVRHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPA
ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQLGFNGGNLTNFFSLPGSRTPEIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTIKCRCLDFNNEIYCQEASCS
PYEVCEPKGKFFYCSAVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF
FSVEAKNEHRGGSAVSWVKELSVEVNGYKILIPKGSYGKVKVNDLVTSLPVTLDLGTVKI
YQSGMSTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV
VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVQCPSF
SHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNQGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCGSGEVCAVEDGYQGCFPKRETVCLLSQNQV
LHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKI
GGIGASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESKGVVTVQYSDIGLLYIRLSTT
YFNCTGGLCGFYNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDTVARY
ASACKNADVEVGPWRTYDFCPLECPENSHFEECITCTETCETLALGPICVDSCSEGCQCD
EGYALLGSQCVTRSECGCNFEGHQLATSETFWVDLDCQIFCYCNGTDNRVHCETIPCEDD
EYCMEEGGLYYCQARTDASCIVSGYGHYLTFDGFPFDFQTSCPLILCTTGSRPSSDSFPK
FVVTAKNEDRDPSLALWVKQVDMTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINI
FSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPMGLLA
SSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAAFSKCHSKVNP
TFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGIPVTGWRNYTSCTVTCPPNSHYES
CVSVCQPRCAAIRLKSDCSHYCVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLF
WNSDCTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDG
AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIISPVYFYINEEQILINDRN
TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG
LCGNFNGDLTDDYVALRGKPVVSSVVLAQSWKTNGMQKSDLLPPSCNELQFSQYAAMCDN
VHIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHKKFQLCGSLAAYGE
ACRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDI
IDAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGN
IVQSNGTHIMYKNTLWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVI
NLTVPTQEGSFITKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADATHLILTLNK
CYATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLH
CAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICT
SRVDGPLCSCVTGTLQEDGKSCRASNSSIELQVWTLLLIMIQISLWHFVYKSGTTS
Download sequence
Identical sequences ENSGGOP00000021662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]