SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021663 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021663
Domain Number 1 Region: 743-933
Classification Level Classification E-value
Superfamily Fibronectin type III 5.91e-39
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 2 Region: 1154-1249
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-20
Family I set domains 0.0059
Further Details:      
 
Domain Number 3 Region: 629-744
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 29-123
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-18
Family I set domains 0.0079
Further Details:      
 
Domain Number 5 Region: 1033-1133
Classification Level Classification E-value
Superfamily Fibronectin type III 8.86e-16
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 6 Region: 458-546
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000218
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 555-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000136
Family I set domains 0.0082
Further Details:      
 
Domain Number 8 Region: 942-1044
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000179
Family I set domains 0.03
Further Details:      
 
Domain Number 9 Region: 307-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000639
Family I set domains 0.021
Further Details:      
 
Domain Number 10 Region: 218-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000144
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021663   Gene: ENSGGOG00000028604   Transcript: ENSGGOT00000024807
Sequence length 1251
Comment pep:known_by_projection chromosome:gorGor3.1:1:181118157:181154515:1 gene:ENSGGOG00000028604 transcript:ENSGGOT00000024807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKLRKSHIPGVSIWQLVEEIPEGCGTPDFEQKPVTLALPEGKNAVFRAVVCGEPRPEV
RWQNSKGDLSDSSKYKISSSPGSKEHVLQINKLTGEDTDLYRCTAVNAYGEAACSARLTV
IEVGFRKNRKRHREPQEDLRKELMDFRKLLKKRAPPAPKKKMDLEQIWQLLMTADRKDYE
KICLKYGIVDYRGMLRRLQEMKKEQEDKMAQYINAISSLRHIRVTKDGNAKFYLELDLKD
SQSKIYLYKDGEMIPYGFNNQTKHCLRRLGKRYEFQIQDLRPEDSGIYQVKVEDAVVFST
ELEASAIPPRVVVPLAETHCEEQGDAVFECTLSSPCPSAAWHFRHRLLHPSDKYEVFVSP
DGLTHRLVVRGARFSDIGPYSLGTGLYTSSAWLVVEAGKDKDLQSTSADHQLQSRRSGKD
SRLDIYGERRDATWSSTSRYKPGTGSFSKDARGPMGHFSQGLADMEVQPGEAATLSCTLT
SDLGPGTWFKDGIKLTAQDGVIFKQDGLVHSLFITHVQGTQAGRYTFVAGDQQSEATLTV
QDSPTIAPDVTEKLREPLVVKAGKPVIVKIAFQSHLPIQAAWRKDGAEVVGSSDREAQVD
LGDGYTRLCLPSAGRKDCGQYSVTLRSEGGSVQAELTLQVIDKPDPPQGPMEVQDCHRAG
VCLRWRPPRDDGGRTVECYVVERRQAGRSTWLKVGEAPADSTTFKDAHVEPGRKYAFRVR
AVTSEGAGEALESEEILVAPEALPKAPSVPAILSASSQGITLTWAAPRGPGSAHILGYLI
ERRKKGSNTWTAVNDQPVPERRWTVADVRQGCQYEFRVTAVAPSGPGEPGPPSDAVFARD
PMRPPGPVRNLQVTDRSNTSITLSWAGPDTQDGDEAQGYVVELCSSDSLQWLPCHVGTVP
VTTYTAKGLRPGEGYFVRVTAVNEGGQSQPTALDTLVQAMPVTVCPKFLVDSSTKDLLTV
KVGDTVRVPVSFEAMPMPEVTWLKDGLPLPKRSVTVTKDGLTQLLIPVAGLSDSGLYTVV
LRTLQGKEVAHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTR
SSAHGPWREAADRIHTNRFTLLGILPGHEYHLRVVAKNELGASKPSDTSQPWCIPQQRDR
FTVKAPSYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGN
PAVYSTDLLGVCSLTIPSVSPKDSGEYKAVAENTLGQAVSTATLIVIEPST
Download sequence
Identical sequences ENSGGOP00000021663 ENSGGOP00000021663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]