SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021709 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021709
Domain Number 1 Region: 42-382
Classification Level Classification E-value
Superfamily L domain-like 2.64e-56
Family Ngr ectodomain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 426-513
Classification Level Classification E-value
Superfamily Immunoglobulin 3.1e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 526-593
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000129
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021709   Gene: ENSGGOG00000026541   Transcript: ENSGGOT00000023354
Sequence length 708
Comment pep:known_by_projection chromosome:gorGor3.1:7:108854516:108888754:1 gene:ENSGGOG00000026541 transcript:ENSGGOT00000023354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDMPLRIHVLLGLAITTLVQAVDKKVDCPRLCTCEIRPWFTPRSIYMEASTVDCNDLGL
LTFPARLPANTQILLLQTNNIAKIEYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLS
VYLEENKLTELPEKCLSKLSNLQELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMIN
SKWFDALPNLEILMIGENPIIRIKDMNFKPLINLRSLVIAGINLTEIPDNALVGLENLES
ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELISI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL
KEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCMDPPEFQGQNVRQVHFRDMMEICL
PLIAPESFPSNLNVEAGSYVSFHCRATAEPQPEIYWITPSGQKLLPNTLTDKFYVHSEGT
LDINGVTPKEGGLYTCIATNLVGADLKSVMIKVDGSFPQDNNGSLNIKIRDIQANSVLVS
WKASSKILKSSVKWTAFVKTENSHAAQSARIPSDVKVYNLTHLNPSTEYKICIDIPTIYQ
KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLSPEMNCDGGHS
YVRNYLQKPTFALGELYPPLINLWEAGKEKSTSLKVKATVIGLPTNMS
Download sequence
Identical sequences G3S0W4
XP_004046103.1.27298 XP_004046104.1.27298 ENSGGOP00000021709 ENSGGOP00000021709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]