SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021732 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021732
Domain Number 1 Region: 45-163
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.96e-40
Family Frizzled cysteine-rich domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 197-305
Classification Level Classification E-value
Superfamily TIMP-like 9.81e-18
Family Tissue inhibitor of metalloproteinases, TIMP 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021732   Gene: ENSGGOG00000022312   Transcript: ENSGGOT00000034035
Sequence length 368
Comment pep:known_by_projection chromosome:gorGor3.1:7:38617665:38628670:-1 gene:ENSGGOG00000022312 transcript:ENSGGOT00000034035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGREGRFLSAGVAAREGSAMFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWN
ITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCK
SVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPD
MMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSRNYSYVIHAKIKAVQRSGCNEVTTVV
DVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRD
QLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQ
KRTNPKRV
Download sequence
Identical sequences ENSGGOP00000021732 ENSGGOP00000021732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]