SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021733 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021733
Domain Number 1 Region: 43-165
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000205
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021733   Gene: ENSGGOG00000000616   Transcript: ENSGGOT00000025962
Sequence length 204
Comment pep:known_by_projection chromosome:gorGor3.1:20:35441811:35487478:1 gene:ENSGGOG00000000616 transcript:ENSGGOT00000025962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNPAPGTALFTETPHDMTARTGEDVEM
ACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVG
SNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAA
PAPPPPKPGKELRKRSVDQEACSL
Download sequence
Identical sequences ENSGGOP00000000607 ENSGGOP00000021733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]