SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021756 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021756
Domain Number 1 Region: 7-340
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-104
Family ALDH-like 0.0000000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021756   Gene: ENSGGOG00000015729   Transcript: ENSGGOT00000022485
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:11:64585780:64591279:-1 gene:ENSGGOG00000015729 transcript:ENSGGOT00000022485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMKLDSVFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISQGTEKVLA
EVLPQYLDQSCFAMVLGGPQETGQLLQHKLDYIFFMGSPRVGKIVMTAATKYLTPVTLEL
GGKNPCYVDDNCDPQTMANPVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRF
YGDNPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDCYIAPTVLVDVQETEPVM
QEEIFRPILPIVNVQSVDEAIEFINRREKPLALYAFSNSSQVVNQMLERTSSGSFGGNEG
FTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIRYPPYTDWNQ
QLLRWGMGSQSCTLL
Download sequence
Identical sequences ENSGGOP00000021756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]