SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021769 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021769
Domain Number 1 Region: 27-119
Classification Level Classification E-value
Superfamily Immunoglobulin 9.6e-25
Family I set domains 0.0014
Further Details:      
 
Domain Number 2 Region: 121-213
Classification Level Classification E-value
Superfamily Immunoglobulin 6.99e-22
Family I set domains 0.0000431
Further Details:      
 
Domain Number 3 Region: 216-312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-21
Family I set domains 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021769   Gene: ENSGGOG00000005196   Transcript: ENSGGOT00000031743
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:19:52228291:52240238:1 gene:ENSGGOG00000005196 transcript:ENSGGOT00000031743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLMVISMACVGFFLLQGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRFRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHRDPLRLVGQLHDAGSQVNYSMGPM
TPALAGTYRCFGSVTHLPYELSAPGDPLDIMVIGLYGKPSLSAQPGPTVQAGENVTLSCS
SRSSYDIYHLSREEEAHERRLPTVRSINGTFQADFPLGPANHGVTYRCFGSFRDSPYEWS
DPSDPLLVSVTGNSRHLHVLTGTSVVIIPFAILLFFLLHRWCANKKNAAVMDQEPAGKRT
VNREDSDEQEPQEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTSM
Download sequence
Identical sequences ENSGGOP00000021769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]