SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021788 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021788
Domain Number - Region: 251-288
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.011
Family Frizzled cysteine-rich domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021788   Gene: ENSGGOG00000028184   Transcript: ENSGGOT00000028392
Sequence length 555
Comment pep:known_by_projection chromosome:gorGor3.1:13:76170890:77358239:1 gene:ENSGGOG00000028184 transcript:ENSGGOT00000028392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRIC
PQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSL
NDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQY
HFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSP
TPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAE
RLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENF
NTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEE
ECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNG
NDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAMDPDRREVDSSAAQRGHSLLS
WSLTCIVLALQRLCR
Download sequence
Identical sequences G3S143
XP_004054693.1.27298 ENSGGOP00000021788 ENSGGOP00000021788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]