SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021874 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021874
Domain Number 1 Region: 128-355
Classification Level Classification E-value
Superfamily L domain-like 5.1e-44
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 2 Region: 383-687
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.11e-42
Family Rhodopsin-like 0.00054
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021874   Gene: ENSGGOG00000013198   Transcript: ENSGGOT00000025547
Sequence length 736
Comment pep:known_by_projection chromosome:gorGor3.1:4:168902398:169054152:1 gene:ENSGGOG00000013198 transcript:ENSGGOT00000025547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGSVFFYILIIGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECSFHFFLFITLLFLVPHCHHALPLPL
DSVVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQ
KLYLQNNKITSISIYAFRGLNSLTKLVLMNNVLTRLPDKPLCQHMPRLHWLDLEGNHIHN
LRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKEL
SQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQYCG
YAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTCFGNIFVICMRPYIRSENKLYA
MSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWMESTHCQLVGSLAILSTEVSVL
LLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGFIVAFIPLSNKEFFKNYYGTNG
VCFPLHSEDTESIGAQIYSVAIFLGINLGAFIIIVFSYGSMFYSVHQSAITATEIRNQVK
KEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGTITSWVVIFILPINSALNPILY
TLTTRPFKEMIHRFWDNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYP
CEMSLISQSTRLNSYS
Download sequence
Identical sequences ENSGGOP00000021874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]