SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021943 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021943
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.41e-26
Family Frizzled cysteine-rich domain 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021943
Domain Number - Region: 131-240
Classification Level Classification E-value
Superfamily TIMP-like 0.000267
Family Tissue inhibitor of metalloproteinases, TIMP 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021943   Gene: ENSGGOG00000027153   Transcript: ENSGGOT00000023810
Sequence length 259
Comment pep:novel chromosome:gorGor3.1:3:50248166:50250396:-1 gene:ENSGGOG00000027153 transcript:ENSGGOT00000023810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCMPIPQAMALCHDIGYQMRLPNLLDHITAAEAIQQLVSWLLLLAWECHPNARLFLCYL
PLYALTERVIYPSYSLCEAMQASCEPIMACYSYPWPAILHCGRFPLGHDLCITAVANNGS
RLDRPSLRASCRDCELQDAGSSKEVLDTLCTSDFAVKVRFSRPNSTSSGPWDCNLYSRLE
VLKTGPLPPAELEPTLQRRLQLDVTCVYNLFRGRHTGTYVLSGKMEACWLLVTTAYAWSQ
GHQNFRLAVCHWHPHQCQE
Download sequence
Identical sequences ENSGGOP00000021943 ENSGGOP00000021943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]